The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.99 Angstrom resolution crystal structure of a short chain dehydrogenase from Bacillus anthracis str. 'Ames Ancestor'. To be Published
    Site CSGID
    PDB Id 3imf Target Id IDP02325
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS30420,261594, 47778260 Molecular Weight 27645.44 Da.
    Residues 254 Isoelectric Point 6.34
    Sequence mkekvviitggssgmgkgmatrfakegarvvitgrtkekleeakleieqfpgqiltvqmdvrntddiqk mieqidekfgridilinnaagnficpaedlsvngwnsvinivlngtfycsqaigkywiekgikgniinm vatyawdagpgvihsaaakagvlamtktlavewgrkygirvnaiapgpiertggadklwiseemakrti qsvplgrlgtpeeiaglayylcsdeaayingtcmtmdggqhlhqypf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.99 Rfree 0.20643
    Matthews' coefficent 2.29 Rfactor 0.16609
    Waters 598 Solvent Content 46.30

    Ligand Information
    Ligands ACT (ACETATE) x 2


    Google Scholar output for 3imf

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch