.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ijw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of BA2930 in complex with CoA. To be Published
    Site CSGID
    PDB Id 3ijw Target Id IDP00044
    Related PDB Ids 3n0s 3kzl 3n0m 3e4f 
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS24639,198094, 30257522 Molecular Weight 29606.37 Da.
    Residues 265 Isoelectric Point 5.60
    Sequence mndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmeviteegtiimpt qssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfrtypnvvrsnhplgsfaawgr haeeitvnqslsmslgeesplrkiydldgyilligvgydsntsvhlsevrsgacelikvgapiienger vwkefvdmdydsdkfveigvefeqkgtvtmgkignakcrlmkqrdivdfgtewfrkkn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.23065
    Matthews' coefficent 2.23 Rfactor 0.18567
    Waters 336 Solvent Content 44.85

    Ligand Information
    Ligands ACO (ACETYL) x 2
    Metals MG (MAGNESIUM) x 1;CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 3ijw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch