.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ij5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.95 Angstrom Resolution Crystal Structure of 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase from Yersinia pestis. TO BE PUBLISHED
    Site CSGID
    PDB Id 3ij5 Target Id IDP02274
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS30418,214092, 16123722 Molecular Weight 20298.20 Da.
    Residues 187 Isoelectric Point 4.86
    Sequence msntayidtcygpvaddviqraanirllicdvdgvmsdgliymgnqgeelkafnvrdgygirclitsdi dvaiitgrraklledrantlgithlyqgqsdklvayhellatlqcqpeqvayigddlidwpvmaqvgls vavadahplllpkahyvtrikggrgavrevcdlillaqdklegatglsi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.20236
    Matthews' coefficent 2.31 Rfactor 0.16328
    Waters 680 Solvent Content 46.83

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 3ij5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch