.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ij3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.8 Angstrom Resolution Crystal Structure of Cytosol Aminopeptidase from Coxiella burnetii. TO BE PUBLISHED
    Site CSGID
    PDB Id 3ij3 Target Id IDP01962
    Molecular Characteristics
    Source Coxiella burnetii rsa 493
    Alias Ids TPS30406,227377, 29541173 Molecular Weight 50885.65 Da.
    Residues 458 Isoelectric Point 5.56
    Sequence madcyltekkknfipiqpmmpdelpdwldtqdartqqwvkasgfvglagticsipestgalqrvllgvs dyeyswdfgglskvlppgafqlnrddfeddeyyerallafglgsyqfnayrkrspylaklflpqahrkr vtdwlttiylirdlintpaedmgpselaqavkhvakefeakvkiieskdletefpaiyavgragsrppl lidlkwgdikapkvtlvgkgvcfdsggldiktpggmllmkkdmggaahalglarmimlqqlpvrlrlli pavenaigsrsyrpgdvvqtrarktieitntdaegrvvladalaeavkedpdliidfstltgaarialg pnlpalfanqdslaqalidaslktddplwrlplfqpyrnylksevadltnssqnrmagaitaalflqhf vsdqipwahfdifawnledlpgrpiggeamalravfhyleqqyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.17685
    Matthews' coefficent 2.67 Rfactor 0.14705
    Waters 426 Solvent Content 53.96

    Ligand Information
    Ligands SO4 (SULFATE) x 5;EDO (1,2-ETHANEDIOL) x 3;PEG (DI(HYDROXYETHYL)ETHER) x 1;PGE (TRIETHYLENE) x 2;PG4 (TETRAETHYLENE) x 3
    Metals CL (CHLORIDE) x 1;LI (LITHIUM) x 1

    Jmol

     
    Google Scholar output for 3ij3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch