.
The Open Protein Structure Annotation Network
PDB Keyword
.

3igx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.85 Angstrom Resolution Crystal Structure of Transaldolase B (talA) from Francisella tularensis. TO BE PUBLISHED
    Site CSGID
    PDB Id 3igx Target Id IDP02095
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS30414,177416, 56708176 Molecular Weight 35686.29 Da.
    Residues 321 Isoelectric Point 6.06
    Sequence mqksvleqlkqvtmvvadtgdfelikkykpvdattnpslilkavkeqkysnlvaetiskvkannpdlns ddlvkeiaieilvsfgikildviegkvssevdarvsfnsattidyakriiaryesngipkdrvlikiaa twegikaakllqkegincnltlifdkaqakacaeagvylvspfvgritdwqmqqnnlktfpaiadddgv nsvkaiyklykshgfktivmgasfrnveqvialagcdaltispvlleelknrdehlevkltknddvvtq spqiseadfrwlmnenamathklaegirlftkdtieleniikqnl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.18598
    Matthews' coefficent 2.43 Rfactor 0.14958
    Waters 881 Solvent Content 49.43

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3igx

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch