.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ife

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.55 Angstrom Resolution Crystal Structure of Peptidase T (pepT-1) from Bacillus anthracis str. 'Ames Ancestor'. To be Published
    Site CSGID
    PDB Id 3ife Target Id IDP02712
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS30434,261594, 47529163 Molecular Weight 45908.36 Da.
    Residues 410 Isoelectric Point 4.76
    Sequence mkeelierftryvkidtqsnedshtvpttpgqiefgkllveelkevgltevtmddngyvmatlpantdk dvpvigflahldtatdftgknvkpqihenfdgnaitlneelnivltpeqfpelpsykghtiittdgttl lgaddkaglteimvamnylihnpqikhgkirvaftpdeeigrgpahfdveafgasfaymmdggplggle yesfnaagakltfngtnthpgtaknkmrnatklamefnghlpveeapeytegyegfyhllslngdveqs kayyiirdfdrknfearkntienivkqmqekygqdavvlemndqyynmlekiepvreivdiayeamksl niepnihpirggtdgsqlsymglptpniftggenyhgkfeyvsvdvmekavqviieiarrfeeqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.17173
    Matthews' coefficent 2.68 Rfactor 0.14836
    Waters 610 Solvent Content 54.10

    Ligand Information
    Ligands SO4 (SULFATE) x 2;SUC (SUCROSE) x 2
    Metals ZN (ZINC) x 2;NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 3ife

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch