.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iac

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.2 Angstrom Crystal Structure of Glucuronate Isomerase from Salmonella typhimurium. To be Published
    Site CSGID
    PDB Id 3iac Target Id IDP02065
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS30410,99287, 16766437 Molecular Weight 53606.96 Da.
    Residues 470 Isoelectric Point 5.24
    Sequence matfmtedfllkndiartlyhkyaapmpiydfhchlspqeiaddrrfdnlgqiwlegdhykwralrsag vdeslitgketsdyekymawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklat pafsargimqqmnvrmvgttddpidsleyhrqiaaddsidievapswrpdkvfkieldgfvdylrklea aadvsitrfddlrqaltrrldhfaacgcrasdhgietlrfapvpddaqldailgkrlagetlseleiaq fttavlvwlgrqyaargwvmqlhigairnnntrmfrllgpdtgfdsigdnniswalsrlldsmdvtnel pktilyclnprdnevlatmignfqgpgiagkvqfgsgwwfndqkdgmlrqleqlsqmgllsqfvgmltd srsflsytrheyfrrilcnllgqwaqdgeipddeamlsrmvqdicfnnaqryftik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.22 Rfree 0.18094
    Matthews' coefficent 3.21 Rfactor 0.14378
    Waters 1166 Solvent Content 61.64

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 3iac

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch