.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i99

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the UDP-N-acetylenolpyruvoylglucosamine reductase from the Vibrio cholerae O1 biovar Tor. To be Published
    Site CSGID
    PDB Id 3i99 Target Id IDP01372
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS30394,243277, 15640345 Molecular Weight 39349.04 Da.
    Residues 357 Isoelectric Point 5.37
    Sequence maslsypkttmqiqlganlkpyhtfgieqlaaqlvvaesiddlkalycsaewaslpkliigkgsnmlft chytgmivvnrlngiehqqdddyhrlhvaggedwpslvswcveqgigglenlalipgcagsapiqniga ygvefkdvcdyveylcletgtvkrltmeecqfgyrdsifkhqlyqkavvtavglkfakawqpiiqygpl kdlssdcaihdvyqrvcatrmeklpdpavmgnagsffknpvisqqafarlqiehpdvvaypaeqgvkva agwlidqaglkghqiggakvhpkqalvivntgdasaqdvlmlaadiqqrvfncygielehevrfigese etnlkqwmseqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.22334
    Matthews' coefficent 2.38 Rfactor 0.16794
    Waters 114 Solvent Content 48.36

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 1;PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3i99

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch