.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i3w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a phosphoglucosamine mutase from Francisella tularensis. To be Published
    Site CSGID
    PDB Id 3i3w Target Id IDP02164
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS30416,177416, 56707258 Molecular Weight 48182.26 Da.
    Residues 443 Isoelectric Point 5.45
    Sequence makyfgtdgirgevanstitveftqklgnavgslinqknypkfvivgqdtrssggflkfalvsglnaag idvldlgvvptpvvafmtvkhraaagfvitashnkftdngiklfssngfklddaleeevedmidgdfiy qpqfkfgsykilanaideyiesiysrfakfvnykgkvvvdcahgaashnfealldkfginyvsiasnpd glninvgcgatcvsnikkavkeqkadlgisldgdadriiivdengqeidgdgilnilaqysdicggtng ivgtqmtnmsyenhyrankipfirskvgdryvledlvkygykiggessghvinlnfgttgdglftaiql laifsqadkpvsefklqgelmqqtlinvpltkkvaredlqkvasdvndvekrlgnrgrvllrpsgtepv lrvmveaddkslatneaeylvekvkqklv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.23642
    Matthews' coefficent 2.48 Rfactor 0.19413
    Waters 265 Solvent Content 50.45

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 3i3w

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch