.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i1i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of homoserine O-acetyltransferase from Bacillus anthracis. To be published
    Site CSGID
    PDB Id 3i1i Target Id IDP01610
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS28074,261594, 47778350 Molecular Weight 42600.70 Da.
    Residues 374 Isoelectric Point 5.87
    Sequence mqivkkekfilkeytfengrtipvqmgyetygtlnrersnvilichyfsatshaagkytahdeesgwwd gligpgkaidtnqyfvictdnlcnvqvknphvittgpksinpktgdeyamdfpvftfldvarmqcelik dmgiarlhavmgpsaggmiaqqwavhyphmvermigvitnpqnpiitsvnvaqnaieairldpswkggk ygeeqpmkglqlanrmmfmnafdehfyettyprnsievepyekvssltsfekeinkltyrsielvdans wmytakavllhdiahgfssleealsnveanvlmipckqdllqpsrynykmvdllqkqgkyaevyeiesi nghmagvfdihlfekkvyeflnrkvssfv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.44 Rfree 0.197
    Matthews' coefficent 3.70 Rfactor 0.161
    Waters 347 Solvent Content 66.75

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2;ACT (ACETATE) x 1;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3i1i

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch