The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the D-alanyl-alanine synthetase A from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2. To be Published
    Site CSGID
    PDB Id 3i12 Target Id IDP00919
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS28053,99287, 16763760 Molecular Weight 39354.65 Da.
    Residues 364 Isoelectric Point 5.39
    Sequence maklrvgivfggksaehevslqsaknivdaidktrfdvvllgidkagqwhvndaenylqnaddpahial rpsaislaqvpgkhqhqlinaqngqplptvdvifpivhgtlgedgslqgmlrvanlpfvgsdvlssaac mdkdvakrllrdaglniapfitltrtnrhafsfaevesrlglplfvkpanqgssvgvskvaneaqyqqa valafefdhkvvveqgikgreiecavlgndnpqastcgeivlnsefyaydtkyiddngaqvvvpaqips evndkiraiaiqayqtlgcagmarvdvfltadnevvineintlpgftnismypklwqasglgytdlisr lielalerhtannalkttm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.24918
    Matthews' coefficent 2.68 Rfactor 0.19697
    Waters 315 Solvent Content 54.05

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 3i12

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch