.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hyq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Isopentenyl-Diphosphate delta-Isomerase from Salmonella entericase. To be Published
    Site CSGID
    PDB Id 3hyq Target Id IDP01970
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS28078,99287, 16766340 Molecular Weight 20780.43 Da.
    Residues 181 Isoelectric Point 5.11
    Sequence mteehvvlldeqdkpsgtlekyaahtlntplhlafscwlfnedgqllvtrrslskkawpgvwtnsvcgh pqqgetteeaiirrcrfelgveitdltpvyphfsyratdpngivenevcpvfaaratsvlqvnseevmd yqwsefksvwksllatpwafspwmvmqasdeqarerllnycqr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.52 Rfree 0.187
    Matthews' coefficent 2.12 Rfactor 0.163
    Waters 227 Solvent Content 41.96

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3hyq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch