The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.9 Angstrom resolution crystal structure of a NAD synthetase (nadE) from Salmonella typhimurium LT2 in complex with NAD(+). To be Published
    Site CSGID
    PDB Id 3hmq Target Id IDP00960
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS28061,99287, 16764661 Molecular Weight 30481.98 Da.
    Residues 275 Isoelectric Point 5.36
    Sequence mtlqqeiiqalgakphinpeeeirrsvdflkaylktypflkslvlgisggqdstlagklsqmaiaelre etgdnalqfiavrlpygvqadeqdcqdaiafiqpdrvltvnikgavlaseqalreagielsdfvrgnek arermkaqysiagmthgvvvgtdhaaeaitgfftkygdggtdinplhrlnkrqgkqllaalgcpehlyk kvptadleddrpslpdeaalgvtydniddylegktldpaiaktiegwyvktehkrrlpitvfddfwkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.18660
    Matthews' coefficent 2.97 Rfactor 0.14404
    Waters 441 Solvent Content 58.64

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 3hmq

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch