The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.5 Angstrom Crystal Structure of Glucose-6-phosphate Isomerase from Vibrio cholerae. To be Published
    Site CSGID
    PDB Id 3hjb Target Id IDP01329
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS28070,243277, 15640401 Molecular Weight 60687.57 Da.
    Residues 550 Isoelectric Point 5.65
    Sequence mlkninptqtqawkaltahfesaqdmdlkalfaqdserfakysarfgqdilvdysknlvnaetmqhlfa laketdlqsaitamfkgeainqtedravlhtalrnrsnspvlvngedvmpavnavlakmkafservigg ewkgftgkaitdvvnigiggsdlgpymvtealvpyknhltmhfvsnvdgthmaetlknvdpettlflva sktfttqetmtnahtardwflkaagdeahvakhfaalstngkavaefgidtdnmfefwdwvggryslws aiglsiilsigydnfvellagahemdqhfvntpfesnipvilaligiwynnfhgaeseailpydqylhr faayfqqgnmesngkyvdrngnpvtyqtgpiiwgepgtngqhafyqlihqgtklipcdfiapavshnlv gdhhqklmsnffaqtealafgksaqavqaelekagksaaeiaalvpfkvfegnrptnsilvkqitprtl gnliamyehkifvqgviwnifsfdqwgvelgkqlanqilpeladsaavtshdsstnglinafkafra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.50 Rfree 0.15070
    Matthews' coefficent 2.46 Rfactor 0.12653
    Waters 4342 Solvent Content 50.10

    Ligand Information
    Metals CA (CALCIUM) x 10;CL (CHLORIDE) x 26;NA (SODIUM) x 2


    Google Scholar output for 3hjb

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch