.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hid

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the adenylosuccinate synthetase from Yersinia pestis CO92. To be Published
    Site CSGID
    PDB Id 3hid Target Id IDP00422
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS28051,214092, 16120713 Molecular Weight 47275.50 Da.
    Residues 432 Isoelectric Point 5.38
    Sequence mgknvvvlgtqwgdegkgkvvdllterakyvvryqgghnaghtlvingektvlhlipsgilrenvisii gngvvlapdalmkemteleargvpvrerlllseacplilpyhvaldnarekargakaigttgrgigpay edkvarrglrvsdlfnketfaiklkeiveyhnfqlvhyykeaavdyqkvlddvlaiadiltamvvdvse lldnarkqgelimfegaqgtlldidhgtypyvtssnttaggvatgsglgpryvdyvlgivkaystrvga gpfptelndetgeflrkqgneygattgrsrrtgwldivavrravqinslsgfcmtkldvldglkevklc vgyrmpdgrevdttplaaegwegiepiyetmpgwsettfgvkehsklpqaalnyiqrveeltgvpidii stgpdrdetmilrdpfda
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.19756
    Matthews' coefficent 2.50 Rfactor 0.16022
    Waters 651 Solvent Content 50.74

    Ligand Information
    Ligands PG6 (1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-) x 1
    Metals

    Jmol

     
    Google Scholar output for 3hid

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch