.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hho

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of chaperone HscB from Vibrio cholerae. To be Published
    Site CSGID
    PDB Id 3hho Target Id IDP01304
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS28068,243277, 15640770 Molecular Weight 19626.34 Da.
    Residues 171 Isoelectric Point 4.74
    Sequence mnyfelfglpiqfeldgsllssqfralqkrfhpdnfataserdrlmavqqaaqindayqtlkdplrrae yllslqgiemnaeqqtlqdpmflmeqmelreelesvtacadpeaalvafdtkvtamqrhylaqlqgqla qsewlaaadqirklkfiaklknevervedqllg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.15 Rfree 0.235
    Matthews' coefficent 2.42 Rfactor 0.200
    Waters 116 Solvent Content 49.27

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 6

    Jmol

     
    Google Scholar output for 3hho

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch