.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h83

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.06 Angstrom resolution structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-1) from Bacillus anthracis str. 'Ames Ancestor'. To be Published
    Site CSGID
    PDB Id 3h83 Target Id IDP01892
    Related PDB Ids 3hvu 3kb8 
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS26806,261594, 47525317 Molecular Weight 20207.36 Da.
    Residues 180 Isoelectric Point 5.00
    Sequence mmnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtdtylemdfmavss yghstvstgevkilkdldtsvegrdilivediidsgltlsylvdlfkyrkaksvkivtlldkptgrkvd lkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsvysn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.06 Rfree 0.20753
    Matthews' coefficent 2.81 Rfactor 0.16841
    Waters 526 Solvent Content 56.23

    Ligand Information
    Ligands SUC (SUCROSE) x 3;PO4 (PHOSPHATE) x 10
    Metals

    Jmol

     
    Google Scholar output for 3h83

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch