.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h1s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of superoxide dismutase from Francisella tularensis subsp. tularensis SCHU S4. To be Published
    Site CSGID
    PDB Id 3h1s Target Id IDP01808
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS26804,177416, 56707247 Molecular Weight 21938.47 Da.
    Residues 192 Isoelectric Point 5.39
    Sequence mkfelpklpyavdalestisketieyhygkhhqtyvtnlnnlvegtehdgrnleeivktsnggifnnaa qvfnhtfywncltpnkteassqlkaalietfgsvenfkeqfskaaiatfgsgwawlvkntegkleivtt snagcpltenkkplltfdvwehayyidyrnarpkyvealwdivnwqfvseqfad
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.20502
    Matthews' coefficent 2.42 Rfactor 0.16485
    Waters 252 Solvent Content 49.17

    Ligand Information
    Ligands GOL (GLYCEROL) x 3
    Metals FE (FE) x 2

    Jmol

     
    Google Scholar output for 3h1s

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch