The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.15 Angstrom Resolution Crystal Structure of Naphthoate Synthase from Salmonella typhimurium. TO BE PUBLISHED
    Site CSGID
    PDB Id 3h02 Target Id IDP00995
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26780,99287, 16765634 Molecular Weight 31691.43 Da.
    Residues 285 Isoelectric Point 5.61
    Sequence miypdetmlyapvewhdcsegytdiryekstdgiakitinrpqvrnafrpltvkemiqaladaryddnv gviiltgegdkafcaggdqkvrgdyggyqddsgvhhlnvldfqrqirtcpkpvvamvagysiggghvlh mmcdltiaaenaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydaqqaldmglvntvvpl adleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfymteegqegrnafnqkrqp dfskfkrnp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.21520
    Matthews' coefficent 1.96 Rfactor 0.16858
    Waters 652 Solvent Content 37.18

    Ligand Information
    Ligands SO4 (SULFATE) x 2;BCT (BICARBONATE) x 7


    Google Scholar output for 3h02

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch