.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gsd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.05 Angstrom Structure of a Divalent-cation Tolerance Protein (CutA) from Yersinia pestis. TO BE PUBLISHED
    Site CSGID
    PDB Id 3gsd Target Id IDP00456
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS26742,214092, 16120681 Molecular Weight 13172.13 Da.
    Residues 119 Isoelectric Point 4.43
    Sequence msdsdamtdpnavsysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyev qllfksntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.05 Rfree 0.20039
    Matthews' coefficent 2.69 Rfactor 0.15648
    Waters 1207 Solvent Content 54.21

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 12;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 13;EDO (1,2-ETHANEDIOL) x 3
    Metals NA (SODIUM) x 22

    Jmol

     
    Google Scholar output for 3gsd

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch