.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gos

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase from Yersinia pestis CO92. To be Published
    Site CSGID
    PDB Id 3gos Target Id IDP00571
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS26751,214092, 16121341 Molecular Weight 29935.63 Da.
    Residues 274 Isoelectric Point 5.68
    Sequence mqqlqnvietaferraditpanvdtvtreaithvidlldtgalrvaekidgqwvthqwlkkavllsfri ndnqvmegaetryydkvpmkfagydearfqregfrvvppatvrkgafiarntvlmpsyvnigafvdegt mvdtwatvgscaqigknvhlsggvgiggvleplqanptiiedncfvgarsevvegviveegsvismgvf igqstriydretgevhygrvpagsvvvsgnlpskdgsyslycavivkkvdaktrskvginellrtid
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.80 Rfree 0.27198
    Matthews' coefficent 2.28 Rfactor 0.22710
    Waters 285 Solvent Content 46.14

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3gos

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch