.
The Open Protein Structure Annotation Network
PDB Keyword
.

3goa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title
    Site CSGID
    PDB Id 3goa Target Id IDP01071
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26788,99287, 16767252 Molecular Weight 41001.94 Da.
    Residues 387 Isoelectric Point 6.42
    Sequence meqvvivdairtpmgrskggafrnvraedlsahlmrsllarnpsltaatlddiywgcvqqtleqgfnia rnaallaeiphsvpavtvnrlcgssmqalhdaarmimtgdaqvclvggvehmghvpmshgvdfhpglsr nvakaagmmgltaemlsrlhgisremqdqfaarsharawaatqsgafkteiiptgghdadgvlkqfnyd evirpettvealstlrpafdpvsgtvtagtssalsdgaaamlvmsesrarelglkprarirsmavvgcd psimgygpvpasklalkkaglsasdidvfemneafaaqilpcikdlglmeqidekinlnggaialghpl gcsgaristtlinlmerkdaqfglatmciglgqgiatvferv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.192
    Matthews' coefficent 2.02 Rfactor 0.142
    Waters 1001 Solvent Content 39.09

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2;NA (SODIUM) x 1;CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 3goa

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch