.
The Open Protein Structure Annotation Network
PDB Keyword
.

3go9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of predicted insulinase family protease from Yersinia pestis. To be Published
    Site CSGID
    PDB Id 3go9 Target Id IDP00573
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS26753,214092, 16124118 Molecular Weight 55442.05 Da.
    Residues 499 Isoelectric Point 5.28
    Sequence mqgtkirlmvgglllaaasnnvqaealqpdpawqqgkldngfswqllatpqrpsdrielrlivntgsls entqevgfahllprlalmssasftpaqlqslwqqgidnerplppaitsydftlyslslpnnrpdllkda lawlsdtagnlavseqtvnaalntatdpiatfpqniqepwwryrlkgsslighdpgqpvtqpvdveklk qfyqqwytpdamtlyvvgnvdsrsiaaqiskafselkgkrtapaavatlaplppepvslmneqaaqdtl slmwdtpwhpiqdsmalsrywrsdlarealfwhikqvleknnqknlklgfdcrvqyqraqcaihlntpv enltanmtfvarelaalranglsqaefdalmtqkndqlsklfatyartdtdilmsqrlrsqqsgvvdia peqyqklrqaflsgltlaelnrelkqqlsqdttlvlmqpkgepevnvkalqeiyngimapqtvaeeeva paeavetapvmpttaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.62 Rfree 0.203
    Matthews' coefficent 2.05 Rfactor 0.166
    Waters 494 Solvent Content 39.93

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals ZN (ZINC) x 6

    Jmol

     
    Google Scholar output for 3go9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch