The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from Salmonella typhimurium. To be Published
    Site CSGID
    PDB Id 3ghz Target Id IDP01038
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26786,99287, 16766235 Molecular Weight 16898.62 Da.
    Residues 159 Isoelectric Point 6.05
    Sequence mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigklfpdtdpafk gadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedlgchmdevnvkattteklg ftgrgegiaceavallmkaak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.03 Rfree 0.205
    Matthews' coefficent 2.41 Rfactor 0.166
    Waters 198 Solvent Content 48.97

    Ligand Information
    Metals MG (MAGNESIUM) x 4


    Google Scholar output for 3ghz

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch