.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gc2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.85 Angstrom Crystal Structure of O-succinylbenzoate Synthase from Salmonella typhimurium in Complex with Succinic Acid. To be Published
    Site CSGID
    PDB Id 3gc2 Target Id IDP00994
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26777,99287, 16765633 Molecular Weight 35358.47 Da.
    Residues 320 Isoelectric Point 4.97
    Sequence mrsaqvyrwqipmdagvvlrdrrlktrdglyvclrdgeregwgeisplpgfsqetweeaqtalltwvnd wlqgseglpempsvafgascalaeltgvlpeaadyraaplctgdpddlvlrladmpgekiakvkvglye avrdgmvvnllleaipdlhlrldanrawtplkaqqfakyvnpdyrariafleepcktrddsrafaretg iaiawdeslreadftfeaeegvravvikptltgsldkvreqvaaahalgltavisssiesslgltqlar iaawltpgtlpgldtlhlmqaqqirpwpgsalpclkreelerll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.18480
    Matthews' coefficent 3.06 Rfactor 0.15500
    Waters 331 Solvent Content 59.79

    Ligand Information
    Ligands SIN (SUCCINIC) x 2;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 1
    Metals CL (CHLORIDE) x 2;NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 3gc2

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch