.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g1z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of yjeA (poxA), a potential t-RNA sythetase from Salmonella typhimurium. To be Published
    Site CSGID
    PDB Id 3g1z Target Id IDP01693
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26800,99287, 16767593 Molecular Weight 36853.79 Da.
    Residues 325 Isoelectric Point 5.11
    Sequence msetatwqpsasipnllkraaimaeirrffadrgvlevetpcmsqatvtdihlfpfetrfvgpghsqgi nlylmtspeyhmkrllaagcgpvfqlcrsfrneemgrhhnpeftmlewyrphydmyrlmnevddllqqv ldcqpaeslsyqqafqrhleidplsadktqlreaaakldlsniadteedrdtllqllftmgvephigke kptfiyhfpasqaslaqistedhrvaerfevyykgielangfheltdareqqqrfeqdnrkraarglpq qpidqnlldalaaglpdcsgvalgvdrlvmlalgaesladviaftvdra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.23920
    Matthews' coefficent 2.24 Rfactor 0.18112
    Waters 645 Solvent Content 45.06

    Ligand Information
    Ligands AMP (ADENOSINE) x 2;PO4 (PHOSPHATE) x 6
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 3g1z

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch