.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g0s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of dihydrodipicolinate synthase from Salmonella typhimurium LT2. To be Published
    Site CSGID
    PDB Id 3g0s Target Id IDP01004
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26782,99287, 16765809 Molecular Weight 31292.26 Da.
    Residues 292 Isoelectric Point 5.66
    Sequence mftgsivalvtpmdekgnvsrsclkklidyhvangtsaivsvgttgesatlshdehgdvvmmtleladg ripviagtganataeaisltqrfndsgivgcltvtpyynrptqeglfqhfkaiaehtdlpqilynvpsr tgcdmlpetvgrlaeikniiaikeatgnltrvhqikelvsddfillsgddasaldfmqlgghgvisvta nvaaremadmcklaaegqfaearainqrlmplhnklfvepnpipvkwackalglvatdtlrlpmtpitd hgrdivkaalqhagll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.190
    Matthews' coefficent 2.29 Rfactor 0.155
    Waters 546 Solvent Content 46.28

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals MG (MAGNESIUM) x 2;CL (CHLORIDE) x 4

    Jmol

     
    Google Scholar output for 3g0s

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch