The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Ferredoxin-NADP Reductase from Salmonella typhimurium. To be Published
    Site CSGID
    PDB Id 3fpk Target Id IDP01074
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26790,99287, 16767350 Molecular Weight 27778.54 Da.
    Residues 248 Isoelectric Point 6.31
    Sequence madwvtgkvtkvqnwtdalfsltvhapinpftagqftklgleidgervqraysyvnapdnpnlefylvt vpqgklsprlaalkpgdevqvvsdasgffvldevpdcetlwmlatgtaigpylsilqygqdvarfknlv lvhaarfaadlsylplmlelqqryegklriqtvvsrenvpgsltgrvpaliengelekavglpmdkets hvmlcgnpqmvrdtqqllketrqmtkhlrrrpghmtaehyw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.223
    Matthews' coefficent 2.37 Rfactor 0.176
    Waters 711 Solvent Content 48.12

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 2
    Metals MG (MAGNESIUM) x 2;CA (CALCIUM) x 1


    Google Scholar output for 3fpk

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch