The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Glucose 6-phosphate Isomerase from Staphylococcus aureus. TO BE PUBLISHED
    Site CSGID
    PDB Id 3ff1 Target Id IDP00736
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS26761,93062, 57285840 Molecular Weight 49805.58 Da.
    Residues 443 Isoelectric Point 4.83
    Sequence mthiqldfsktleffgehelkqqqeivksihktihegtgagsdflgwvdlpvdydkeefsriveaskri kensdvlvvigiggsylgaraaiemltssfrnsneypeivfvgnhlsstytkelvdyladkdfsvnvis ksgtttepavafrlfkqlveerygkeeaqkrifattdkekgalkqlatnegyetfivpddvggrysvlt avgllpiataginieammigaakareelssdkleeniayqyatirnilyakgyttemlinyepsmqyfn ewwkqlfgesegkdfkgiypssanyttdlhslgqyvqegrrflfetvvkvnhpkyditiekdsddldgl nylagktidevntkafegtllahtdggvpnmvvnipqldeetfgyvvyffelacamsgyqlgvnpfnqp gveaykqnmfallgkpgfedlkkeleerl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.170
    Matthews' coefficent 3.44 Rfactor 0.146
    Waters 1520 Solvent Content 64.21

    Ligand Information
    Ligands G6Q (GLUCOSE-6-PHOSPHATE) x 1
    Metals NA (SODIUM) x 4


    Google Scholar output for 3ff1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch