.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f0i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of Arsenate reductase from Vibrio cholerae. To be Published
    Site CSGID
    PDB Id 3f0i Target Id IDP01300
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS26794,243277, 15642164 Molecular Weight 13172.58 Da.
    Residues 116 Isoelectric Point 5.92
    Sequence msvviyhnpkcsksretlallenqgiapqvikyletspsveelkrlyqqlglnevrammrckeelykel nlgdsqlsddalfaamaehpklierpivvcngqarhgrppeqvleil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.88 Rfree 0.189
    Matthews' coefficent 4.10 Rfactor 0.166
    Waters 301 Solvent Content 69.98

    Ligand Information
    Ligands MLI (MALONATE) x 2
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 3f0i

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch