The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.82 Angstrom resolution crystal structure of holo-(acyl-carrier-protein) synthase (acpS) from Staphylococcus aureus. To be Published
    Site CSGID
    PDB Id 3f09 Target Id IDP00816
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS26769,93062, 57284929 Molecular Weight 13604.88 Da.
    Residues 119 Isoelectric Point 6.65
    Sequence mihgigvdlieidriqalyskqpklveriltkneqhkfnnftheqrkieflagrfatkeafskalgtgl gkhvafndidcyndelgkpkidyegfivhvsishtehyamsqvvleksaf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.82 Rfree 0.23220
    Matthews' coefficent 2.16 Rfactor 0.18949
    Waters 314 Solvent Content 43.16

    Ligand Information


    Google Scholar output for 3f09

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch