The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Rhodanese-like Domain Protein from Staphylococcus aureus. To be Published
    Site CSGID
    PDB Id 3eme Target Id IDP00640
    Related PDB Ids 3mzz 
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS24731,93062, 57286241 Molecular Weight 11343.32 Da.
    Residues 103 Isoelectric Point 4.57
    Sequence mksittdelknklleskpvqivdvrtdeetamgyipnaklipmdtipdnlnsfnkneiyyivcaggvrs akvveyleangidavnveggmhawgdegleiksi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.238
    Matthews' coefficent 2.75 Rfactor 0.182
    Waters 184 Solvent Content 55.28

    Ligand Information


    Google Scholar output for 3eme

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch