.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eg7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of Spermidine n1-acetyltransferase from Vibrio cholerae. To be Published
    Site CSGID
    PDB Id 3eg7 Target Id IDP01616
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS24754,243277, 9658384 Molecular Weight 20674.38 Da.
    Residues 173 Isoelectric Point 5.60
    Sequence mnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvvedaqknlig lvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiylhvavenpkavhlyeecg fveeghlveeffingryqdvkrmyilqskylnrse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.38 Rfree 0.26040
    Matthews' coefficent 2.99 Rfactor 0.20542
    Waters 159 Solvent Content 58.82

    Ligand Information
    Ligands IPA (ISOPROPYL) x 2
    Metals MG (MAGNESIUM) x 3

    Jmol

     
    Google Scholar output for 3eg7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch