.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ect

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hexapeptide-Repeat Containing-Acetyltransferase VCA0836 from Vibrio cholerae. To be Published
    Site CSGID
    PDB Id 3ect Target Id IDP01515
    Related PDB Ids 3nz2 
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS24745,243277, 15601591 Molecular Weight 21149.01 Da.
    Residues 192 Isoelectric Point 5.64
    Sequence mkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghkscvqppfhce fgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrrqawetickpivieddvwi ggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparilrslkdpaesmae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.51 Rfree 0.251
    Matthews' coefficent 2.12 Rfactor 0.193
    Waters 68 Solvent Content 42.11

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 3ect

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch