The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the general stress protein 26 from Bacillus anthracis str. Sterne. To be Published
    Site CSGID
    PDB Id 3ec6 Target Id IDP01540
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS24752,261594, 47525694 Molecular Weight 16067.48 Da.
    Residues 138 Isoelectric Point 5.57
    Sequence mhlkekittiiqgqrtgvlstvrndkphsafmmffhedfvlyvatdrqskkitdiennpnvhvllgreg kkldedyieveglasieedstlknkfwnnslkrwllrpedpnyvlikinpdtiyyidgagttepeflrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.227
    Matthews' coefficent 2.02 Rfactor 0.186
    Waters 88 Solvent Content 39.05

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 1;SO4 (SULFATE) x 1


    Google Scholar output for 3ec6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch