.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e9a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from Vibrio cholerae O1 biovar eltor str. N16961. To be Published
    Site CSGID
    PDB Id 3e9a Target Id IDP01337
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS24741,243277, 15642174 Molecular Weight 30771.83 Da.
    Residues 283 Isoelectric Point 5.85
    Sequence mehkivhvgdipvandkpftlfagmnvlesrdlamqicehyvkvtdklgipyvfkasfdkanrssvhsy rgpgleegmkifqelketfgvkiitdvhteaqaqpvadvvdviqlpaflarqtdlveamaktgavinvk kpqfmspgqvgnivekfaecgndkvilcergschgydnlvvdmlgfgvmkqasngspiifdvthslqmr dpsgaasggrreqtvelakaglatgiaglfieahpnpdkarcdgpsalpldklepflaqmkalddliks fahidir
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.215
    Matthews' coefficent 2.16 Rfactor 0.176
    Waters 169 Solvent Content 42.98

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3e9a

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch