The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of d-ribose high-affinity transport system from salmonella typhimurium lt2. To be Published
    Site CSGID
    PDB Id 3e7n Target Id IDP00079
    Related PDB Ids 3dsa 
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS24715,99287, 16422456 Molecular Weight 15188.64 Da.
    Residues 139 Isoelectric Point 5.90
    Sequence mkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvvtremqveaail ateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqavirsgecspyanvilcagvtf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 15
    Resolution (Å) 2.45 Rfree 0.23255
    Matthews' coefficent 2.59 Rfactor 0.19069
    Waters 282 Solvent Content 52.59

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 13


    Google Scholar output for 3e7n

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch