The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.35 Angstrom resolution structure of WecB (VC0917), a UDP-N-acetylglucosamine 2-epimerase from Vibrio cholerae. TO BE PUBLISHED
    Site CSGID
    PDB Id 3dzc Target Id IDP00152
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS24727,243277, 15640933 Molecular Weight 41037.98 Da.
    Residues 372 Isoelectric Point 5.50
    Sequence mkkvlivfgtrpeaikmaplvqqlcqdnrfvakvcvtgqhremldqvlelfsitpdfdlnimepgqtln gvtskillgmqqvlsseqpdvvlvhgdtattfaaslaayyqqipvghveaglrtgniyspwpeegnrkl taaltqyhfaptdtsranllqenynaenifvtgntvidallavrekihtdmdlqatlesqfpmldaskk lilvtghrresfgggfericqalittaeqhpecqilypvhlnpnvrepvnkllkgvsnivliepqqylp fvylmdrahiiltdsggiqeeapslgkpvlvmretterpeavaagtvklvgtnqqqicdalsllltdpq ayqamsqahnpygdgkacqriadilak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.23376
    Matthews' coefficent 2.70 Rfactor 0.17238
    Waters 500 Solvent Content 54.52

    Ligand Information
    Metals CL (CHLORIDE) x 2;CA (CALCIUM) x 2


    Google Scholar output for 3dzc

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch