The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Funded by the national institute of allergy and infectious diseases of nih (contract number hhsn272200700058c). To be Published
    Site CSGID
    PDB Id 3dr6 Target Id IDP00086
    Related PDB Ids 3dr8 
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS24717,99287, 16420114 Molecular Weight 19186.76 Da.
    Residues 171 Isoelectric Point 6.49
    Sequence mtirfadkadcaaiteiynhavlhtaaiwndrtvdtdnrlawyearqllgypvlvseengvvtgyasfg dwrsfdgfrytvehsvyvhpahqgkglgrkllsrlidearrcgkhvmvagiesqnaasirlhhslgftv taqmpqvgvkfgrwldltfmqlqldehaapdac
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.75 Rfree 0.20012
    Matthews' coefficent 2.80 Rfactor 0.16301
    Waters 811 Solvent Content 56.03

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 6;GOL (GLYCEROL) x 1


    Google Scholar output for 3dr6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch