The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative glycerate kinase 2 from Salmonella typhimurium LT2. To be Published
    Site CSGID
    PDB Id 3cwc Target Id IDP00122
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS24725,99287, 16766265 Molecular Weight 39507.61 Da.
    Residues 380 Isoelectric Point 5.09
    Sequence mkiviapdsykeslsalevataieqgfreiwpdadylklpladggegtveamveatagrivhvevtgpl ghrvnafyglsgdarsafiemaaasgleqvppaqrdplkttswgtgelirhaldagvehiiigiggsat ndggagmvqalgarlrdaqgndiaqggigletlasidisgldkrlsachievacdvtnpltgkegasav fgpqkgatpemierldtaltryahliardlhvdvldlagggaaggmgaalyafcgaqlrrgieivtdal hleacladadlvitgegridsqtihgkvpigvaniakrynkpvigiagsltadvsvvhehgldavfsvi ytictledalknasenvrmtarnvaatlkagqqlr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.23 Rfree 0.237
    Matthews' coefficent 2.35 Rfactor 0.188
    Waters 153 Solvent Content 47.73

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 2
    Metals CL (CHLORIDE) x 1


    Google Scholar output for 3cwc

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch