.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ip1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Blocking S-adenosylmethionine synthesis in yeast allows selenomethionine incorporation and multiwavelength anomalous dispersion phasing. Proc.Natl.Acad.Sci.Usa 104 6678-6683 2007
    Site CHTSB
    PDB Id 2ip1 Target Id YOL097C
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS21047,NP_014544.1 Molecular Weight 49347.84 Da.
    Residues 432 Isoelectric Point 6.35
    Sequence msndetvekvtqqvselkstdvkeqvvtpwdveggvdeqgraqnidydklikqfgtkpvneetlkrfkq vtgrephhflrkglffserdftkildlyeqgkpfflytgrgpssdsmhlghmipfvftkwlqevfdvpl vieltddekflfkhkltindvknfarenakdiiavgfdpkntfifsdlqymggafyetvvrvsrqitgs takavfgfndsdcigkfhfasiqiatafpssfpnvlglpdktpclipcaidqdpyfrvcrdvadklkys kpallhsrffpalqgsttkmsasddttaifmtdtpkqiqkkinkyafsggqvsadlhrelggnpdvdva yqylsffkdddvflkecydkyksgellsgemkklcietlqefvkafqerraqvdeetldkfmvphklvw gekerlvapkpktkqekk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.2143
    Matthews' coefficent 2.52 Rfactor 0.18093
    Waters 358 Solvent Content 51.15

    Ligand Information
    Ligands PG4 (TETRAETHYLENE) x 4
    Metals

    Jmol

     
    Google Scholar output for 2ip1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch