.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i5s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural studies of the phosphatidylinositol 3-kinase (PI3K) SH3 domain in complex with a peptide ligand: role of the anchor residue in ligand binding. Biol.Chem. 391 33-42 2010
    Site CESG
    PDB Id 3i5s Target Id GO.80160
    Related PDB Ids 2i5s 
    Molecular Characteristics
    Source Rana pipiens
    Alias Ids TPS26715, Molecular Weight 11844.04 Da.
    Residues 104 Isoelectric Point 8.96
    Sequence qdwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvlttsefylsdcn vtsrpckyklkkstnkfcvtcenqapvhfvgvgsc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 3.00 Rfree 0.299
    Matthews' coefficent 2.27 Rfactor 0.240
    Waters Solvent Content 45.73

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3i5s

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch