.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dcy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure a TP53-induced glycolysis and apoptosis regulator protein from Homo sapiens. To be Published
    Site CESG
    PDB Id 3dcy Target Id GO.40566
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30290, Molecular Weight 30060.95 Da.
    Residues 270 Isoelectric Point 7.60
    Sequence marfaltvvrhgetrfnkekiiqgqgvdeplsetgfkqaaaagiflnnvkfthafssdlmrtkqtmhgi lerskfckdmtvkydsrlrerkygvvegkalselramakaareecpvftppggetldqvkmrgidffef lcqlilkeadqkeqfsqgspsncletslaeifplgknhsskvnsdsgipglaasvlvvshgaymrslfd yfltdlkcslpatlsrselmsvtpntgmslfiinfeegrevkptvqcicmnlqdhlngltetr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.229
    Matthews' coefficent 2.10 Rfactor 0.180
    Waters 266 Solvent Content 40.60

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3dcy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch