.
The Open Protein Structure Annotation Network
PDB Keyword
.

3caz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a BAR protein from Galdieria sulphuraria. To be Published
    Site CESG
    PDB Id 3caz Target Id GO.80055
    Molecular Characteristics
    Source Galdieria sulphuraria
    Alias Ids TPS30175, Molecular Weight 35759.07 Da.
    Residues 309 Isoelectric Point 5.71
    Sequence merlspvfatskssnmevehwmtslkevekvldsvepkltssgtkwrvvaqhikdicsdlnqifnkedp ryevvqagasaahdfdvryldihkvrtpheplemrhskgrkhgreiarllekiqkyrqeieeikkeyke tdkyrerydhykvkldnlekknkdqeriernqqkfkdaeaayssvcadliqkmetvwkkhvsifaeaas avwstqlqyakaleaaanpivpylqqeeqeeeeeeeaasgtqgrvaekayhtneekvensfqknsaipp sfrtaseqlteqskninnakntsetspaediea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.34 Rfree 0.252
    Matthews' coefficent 3.01 Rfactor 0.215
    Waters Solvent Content 59.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3caz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch