.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c9q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the uncharacterized human protein C8orf32 with bound peptide. To be Published
    Site CESG
    PDB Id 3c9q Target Id GO.39772
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30204, Molecular Weight 23550.30 Da.
    Residues 205 Isoelectric Point 5.31
    Sequence megngpaavhyqpaspprdacvysscyceenvwklceyiknhdqypleecyavfisnerkmipiwkqqa rpgdgpviwdyhvvllhvssggqsfiydldtvlpfpclfdtyvedaiksdddihpqfrrkfrvicadsy lknfasdrshmkdssgnwreppppypcietgdskmnlndfismdpkvgwgavytlsefthrfgsknc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.180
    Matthews' coefficent 2.60 Rfactor 0.161
    Waters 275 Solvent Content 52.73

    Ligand Information
    Ligands SER-THR-ALA (1,2-ETHANEDIOL) x 1;EDO (SULFATE) x 5;SO4 (CARBONATE) x 5;CO3 x 1
    Metals

    Jmol

     
    Google Scholar output for 3c9q

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch