The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized protein CMQ451C from the primitive red alga Cyanidioschyzon merolae. To be Published
    Site CESG
    PDB Id 3bzb Target Id GO.81400
    Molecular Characteristics
    Source Cyanidioschyzon merolae strain 10d
    Alias Ids TPS30344, Molecular Weight 30992.34 Da.
    Residues 281 Isoelectric Point 6.05
    Sequence mnsraadqleldglpgtppdfyrerqrsrveryqspagaplqcsvqvqttqehplwtshvwsgaralad tlcwqpeliagktvcelgagaglvsivaflagadqvvatdypdpeilnslesnirehtanscssetvkr aspkvvpyrwgdspdslqrctglqrfqvvlladllsfhqahdallrsvkmllalpandptavalvtfth hrphlaerdlaffrlvnadgaliaepwlsplqmdpmfpddpgdvcirgqvhrwrlrwrsaasasanipa harne
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.79 Rfree 0.261
    Matthews' coefficent 2.63 Rfactor 0.209
    Waters 13 Solvent Content 53.26

    Ligand Information


    Google Scholar output for 3bzb

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch