.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bvo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of human J-type co-chaperone HscB reveals a tetracysteine metal-binding domain. J.Biol.Chem. 283 30184-30192 2008
    Site CESG
    PDB Id 3bvo Target Id GO.91296
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30200, Molecular Weight 24040.96 Da.
    Residues 206 Isoelectric Point 5.70
    Sequence aasqagsnyprcwncggpwgpgredrffcpqcralqapdptrdyfslmdcnrsfrvdtaklqhryqqlq rlvhpdffsqrsqtekdfsekhstlvndayktllaplsrglyllklhgieipertdyemdrqflieime ineklaeaeseaamkeiesivkakqkeftdnvssafeqddfeeakeiltkmryfsnieekiklkkipl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.00 Rfree 0.288
    Matthews' coefficent 2.34 Rfactor 0.236
    Waters Solvent Content 47.54

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 3bvo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch