The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Cyclized GFP Variant. To be Published
    Site CESG
    PDB Id 2qu1 Target Id GO.91571
    Molecular Characteristics
    Source Aequorea victoria
    Alias Ids TPS30155, Molecular Weight 26746.78 Da.
    Residues 238 Isoelectric Point 5.67
    Sequence mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvttltygvq cfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvnrielkgidfkedgnilg hkleynynshnvyitadkqkngikanfkirhniedgsvqladhyqqntpigdgpvllpdnhylstqsal skdpnekrdhmvllefvtaagithgmdelyk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.220
    Matthews' coefficent 2.20 Rfactor 0.168
    Waters 377 Solvent Content 42.80

    Ligand Information
    Metals CA (CALCIUM) x 1


    Google Scholar output for 2qu1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch