.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qnk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Human 3-hydroxyanthranilate 3,4-dioxygenase. to be published
    Site CESG
    PDB Id 2qnk Target Id GO.43316
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30350, Molecular Weight 32554.51 Da.
    Residues 286 Isoelectric Point 5.62
    Sequence merrlgvrawvkenrgsfqppvcnklmhqeqlkvmfiggpntrkdyhieegeevfyqlegdmvlrvleq gkhrdvvirqgeifllparvphspqrfantvglvverrrleteldglryyvgdtmdvlfekwfyckdlg tqlapiiqeffsseqyrtgkpipdqllkeppfplstrsimepmsldawldshhrelqagtplslfgdty etqviaygqgsseglrqnvdvwlwqlegssvvtmggrrlslapddsllvlagtsyawertqgsvalsvt qdpackkplg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.176
    Matthews' coefficent 2.60 Rfactor 0.157
    Waters 413 Solvent Content 52.20

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals NI (NICKEL) x 1

    Jmol

     
    Google Scholar output for 2qnk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch