.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q32

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Comparison of Apo- and Heme-bound Crystal Structures of a Truncated Human Heme Oxygenase-2. J.Biol.Chem. 282 37624-37631 2007
    Site CESG
    PDB Id 2q32 Target Id GO.91265
    Related PDB Ids 2qpp 2rgz 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30220, Molecular Weight 30447.78 Da.
    Residues 264 Isoelectric Point 5.21
    Sequence msaevetsegvdesekknsgalekenqmrmadlsellkegtkeahdraentqfvkdflkgnikkelfkl attalyftysaleeemernkdhpafaplyfpmelhrkealtkdmeyffgenweeqvqapkaaqkyveri hyigqnepellvahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmn aldlnmktkeriveeankafeynmqifneldqagstlaretledgfpvhdgkgdmrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.253
    Matthews' coefficent 2.60 Rfactor 0.201
    Waters 154 Solvent Content 52.60

    Ligand Information
    Ligands OXN (OXTOXYNOL-10) x 2
    Metals

    Jmol

     
    Google Scholar output for 2q32

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch